Question

The bovine papillomavirus E5 protein is a small (44-residue) protein with a single transmembrane domain. The E5 protein dimerizes and activtates platelet-derived growth factor. Its primary sequence is MANLWFLLFLGLVAAMQLLLLLFLLLFFLVYWDHFECSCTGLPF . What is the 19 amino acid component of this sequence that is likely to be the hydrophobic transmembrane domain (single letter abbreviations with no spaces)

Answer 1

LVAAMQLLLLLFLLLFFLV

Step-by-step explanation:

Transmembrane domains are hydrophobic regions inserted into the cell membrane, while surrounding protein regions are often designed to localize on opposite sides of the membrane. In general, hydrophobic amino acids are inserted into the hydrophobic core of the membrane. These hydrophobic residues have side-chains which are insoluble in water. Examples of hydrophobic amino acids, such as those observed in the putative hydrophobic transmembrane region, include leucine (L), valine (V), alanine (A), methionine (M) and phenylalanine (F).