Recent activity by Rayhan Muktader

Recent activity by Rayhan Muktader

Agencies of Interest Where would you get your drivers license or photo id issued? Agency or Department: List two additional things this agency does: Where would you get information about voting in an upcoming

answered Dec 16, 2024

1 answer 212k views

Find dy/dx if f(x)=(x+1)^2x. a. 2xln(x+1) b. 2ln(x+1)+2x/(x+1) c. 2x(x+1)(2x-1) d. (2ln(x+1)+2x/(x+1))(x+1)^2x

answered Nov 2, 2024

1 answer 45.9k views

A nurse is developing a plan of care for a client who has cirrhosis and ascites. Which of the following interventions should the nurse include in the plan? A) Measure the client's abdominal girth daily.

asked Oct 19, 2024

1 answer 93.0k views

If 27³+27³+27³=27x,what is the value of x?

answered Sep 4, 2024

2 answers 201k views

Ackert Company's last dividend was $4.75. The dividend growth rate is expected to be constant at 1.5% for 2 years, after which dividends are expected to grow at a rate of 8.0% forever. The firm's required

answered Aug 18, 2024

1 answer 230k views

Before a flat-panel detector can be used for a radiographic exposure, it must be prepared. This preparation is referred to as:__________

asked Aug 16, 2024

1 answer 94.3k views

Withdrawal of uppers makes everything goes?

asked Jul 26, 2024

1 answer 7.3k views

Solve the differential equation: y' = e^y * sin(t). Options: A. y = ln(-sin(t)) B. y = -ln(cos(t) + C) C. y = cos(ln(t)) D. y = e^(-cos(t)) E. None of these

asked Jul 11, 2024

1 answer 215k views

Who was the most accurate group in the 'better than average illusion' experiment?

asked Jun 28, 2024

1 answer 68.5k views

Book tittle :The secret life of Bess I need to know the records,thoughts,questions,and predictions (just the first chapter)

answered May 24, 2024

1 answer 164k views

Which two types of fixed-price contracts are used when acquiring commercial items? a) Firm-fixed-price and fixed-price with economic price adjustment b) Cost-reimbursement and incentive contracts c) Time

answered Jan 29, 2024

1 answer 126k views

I don’t understand I don’t under math smh bio

answered Dec 31, 2023

1 answer 102k views

What conflict caused the Chinese Qing empire which lasted from 1644-1912 to fall down

asked Nov 2, 2023

1 answer 48.8k views

Save & exit 1. What must happen before a bill can be sent to the president? Both houses must pass an identical bill. The Supreme Court must determine the bill's constitutionality. One house must pass the

answered Oct 21, 2023

2 answers 156k views

A. O62.497 JB. O 40 JC. O 29.044 JD.44.934 JE. O48.953 J3. After a bullet of mass 0.055 kg is fired into aballistic pendulum of mass 4 kg. the bullet is embeddedin the pendulum and the pendulum rose to

answered Sep 21, 2023

1 answer 167k views

Which data set represents constant acceleration? 5 4 3 210 0 1 2 3 O 4 2086420 12 10 0 g-axis (mus), O 2 3 4 6 3210543 x-axis (s). Based on the graphs, 0 1 2 3 4 O help

asked Aug 3, 2023

1 answer 187k views

HELP PLEASE 30 POINTS Match the Congruence Theorem that describes how the two triangles are congruent. Fill in the blank

answered Jun 16, 2023

2 answers 43.0k views

Pleasedjhdndndndmwmkqkskdnfndmdmmdmdmdmdmdmf

answered May 23, 2023

1 answer 47.5k views

3x+4/5=7-2x what is the solution to the equation?

answered Apr 18, 2023

1 answer 92.1k views

Write a short narrative telling the story of a day from your life you wish would have gone differently than it did. Be sure to use a sequence of plot events, a consistent point of view, and transitions

asked Mar 3, 2023

1 answer 98.8k views

Search QAmmunity.org